SCOPe 2.04: Domain d3om9d1: 3om9 D:14-163

Lineage for d3om9d1 (3om9 D:14-163)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (6 species)
   not a true protein

7. Species Toxoplasma gondii [TaxId:5811] [233099] (1 PDB entry)

8. Domain d3om9d1: 3om9 D:14-163 [239569]
   Other proteins in same PDB: d3om9a2, d3om9b2, d3om9c2, d3om9d2
   automated match to d3om9a1
   complexed with nad, oxq

Details for d3om9d1

PDB Entry: 3om9, 1.98 Å

PDB Description: T. Gondii bradyzoite-specific LDH (LDH1) in complex with NAD and OXQ

PDB Compounds: (D:) lactate dehydrogenase

SCOPe Domain Sequences for d3om9d1:

Sequence; same for both SEQRES and ATOM records:

>d3om9d1 c.2.1.5 (D:14-163) automated matches {Toxoplasma gondii [TaxId: 5811]}
palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
cpktfiivvtnpldcmvkvmceasgvptnmicgm

Timeline for d3om9d1:

• d3om9d1 is new in SCOPe 2.04-stable
  
• d3om9d1 appears in SCOPe 2.05
  
• d3om9d1 appears in the current release, SCOPe 2.08