Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein automated matches [226881] (6 species) not a true protein |
Species Toxoplasma gondii [TaxId:5811] [233099] (1 PDB entry) |
Domain d3om9d1: 3om9 D:14-163 [239569] Other proteins in same PDB: d3om9a2, d3om9b2, d3om9c2, d3om9d2 automated match to d3om9a1 complexed with nad, oxq |
PDB Entry: 3om9 (more details), 1.98 Å
SCOPe Domain Sequences for d3om9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3om9d1 c.2.1.5 (D:14-163) automated matches {Toxoplasma gondii [TaxId: 5811]} palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky cpktfiivvtnpldcmvkvmceasgvptnmicgm
Timeline for d3om9d1: