Lineage for d3oeut_ (3oeu T:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2224903Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2224975Domain d3oeut_: 3oeu T: [239564]
    Other proteins in same PDB: d3oeu1_, d3oeu2_, d3oeua_, d3oeub_, d3oeuc_, d3oeud_, d3oeue_, d3oeug_, d3oeuh_, d3oeui_, d3oeuj_, d3oeuk_, d3oeul_, d3oeum_, d3oeun_, d3oeuo_, d3oeup_, d3oeuq_, d3oeur_, d3oeus_, d3oeuu_, d3oeuv_, d3oeuw_, d3oeux_, d3oeuy_, d3oeuz_
    automated match to d3oeuf_
    complexed with mes, mg, oeu

Details for d3oeut_

PDB Entry: 3oeu (more details), 2.6 Å

PDB Description: Structure of yeast 20S open-gate proteasome with Compound 24
PDB Compounds: (T:) Proteasome component C1

SCOPe Domain Sequences for d3oeut_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oeut_ d.153.1.4 (T:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknvkiqvvd
rhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtlynsvrp
fgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpeglsare
avkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqkein

SCOPe Domain Coordinates for d3oeut_:

Click to download the PDB-style file with coordinates for d3oeut_.
(The format of our PDB-style files is described here.)

Timeline for d3oeut_: