SCOPe 2.06: Domain d3oeex3: 3oee X:358-475

Lineage for d3oeex3 (3oee X:358-475)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310898] (6 PDB entries)

8. Domain d3oeex3: 3oee X:358-475 [239562]
   Other proteins in same PDB: d3oeed1, d3oeed2, d3oeee1, d3oeee2, d3oeef1, d3oeef2, d3oeeg_, d3oeeh1, d3oeeh2, d3oeei_, d3oeem1, d3oeem2, d3oeen1, d3oeen2, d3oeeo1, d3oeeo2, d3oeep_, d3oeer_, d3oeev1, d3oeev2, d3oeew1, d3oeew2, d3oeex1, d3oeex2, d3oeey_
   automated match to d2jdid1
   complexed with anp, mg, po4; mutant

Details for d3oeex3

PDB Entry: 3oee, 2.74 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: alpha-F405S

PDB Compounds: (X:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oeex3:

Sequence; same for both SEQRES and ATOM records:

>d3oeex3 a.69.1.1 (X:358-475) F1 ATP synthase beta subunit, domain 3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa

Timeline for d3oeex3:

• d3oeex3 first appeared in SCOPe 2.04
  
• d3oeex3 appears in SCOPe 2.05
  
• d3oeex3 appears in SCOPe 2.07
  
• d3oeex3 appears in the current release, SCOPe 2.08