Lineage for d3oeeo1 (3oee O:7-82)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798608Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2798609Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2798680Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species)
  7. 2798683Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310896] (6 PDB entries)
  8. 2798698Domain d3oeeo1: 3oee O:7-82 [239551]
    Other proteins in same PDB: d3oeed2, d3oeed3, d3oeee2, d3oeee3, d3oeef2, d3oeef3, d3oeeg_, d3oeeh1, d3oeeh2, d3oeei_, d3oeem2, d3oeem3, d3oeen2, d3oeen3, d3oeeo2, d3oeeo3, d3oeep_, d3oeer_, d3oeev2, d3oeev3, d3oeew2, d3oeew3, d3oeex2, d3oeex3, d3oeey_
    automated match to d2jdid2
    complexed with anp, mg, po4; mutant

Details for d3oeeo1

PDB Entry: 3oee (more details), 2.74 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: alpha-F405S
PDB Compounds: (O:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oeeo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oeeo1 b.49.1.1 (O:7-82) F1 ATP synthase beta subunit, domain 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
teglvrgekvldtggp

SCOPe Domain Coordinates for d3oeeo1:

Click to download the PDB-style file with coordinates for d3oeeo1.
(The format of our PDB-style files is described here.)

Timeline for d3oeeo1: