Lineage for d3nzwf_ (3nzw F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1679108Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 1679109Protein automated matches [190509] (9 species)
    not a true protein
  7. 1679123Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (12 PDB entries)
  8. 1679128Domain d3nzwf_: 3nzw F: [239523]
    Other proteins in same PDB: d3nzw1_, d3nzw2_, d3nzwa_, d3nzwb_, d3nzwc_, d3nzwd_, d3nzwe_, d3nzwg_, d3nzwh_, d3nzwi_, d3nzwj_, d3nzwk_, d3nzwl_, d3nzwm_, d3nzwn_, d3nzwo_, d3nzwp_, d3nzwq_, d3nzwr_, d3nzws_, d3nzwu_, d3nzwv_, d3nzww_, d3nzwx_, d3nzwy_, d3nzwz_
    automated match to d1irug_
    complexed with mes

Details for d3nzwf_

PDB Entry: 3nzw (more details), 2.5 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with 2b
PDB Compounds: (F:) Proteasome component C1

SCOPe Domain Sequences for d3nzwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nzwf_ d.153.1.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d3nzwf_:

Click to download the PDB-style file with coordinates for d3nzwf_.
(The format of our PDB-style files is described here.)

Timeline for d3nzwf_: