Lineage for d3nzjf_ (3nzj F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2554828Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2554829Protein automated matches [190509] (16 species)
    not a true protein
  7. 2554848Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (16 PDB entries)
  8. 2554849Domain d3nzjf_: 3nzj F: [239517]
    Other proteins in same PDB: d3nzj1_, d3nzj2_, d3nzja_, d3nzjb_, d3nzjc_, d3nzjd_, d3nzje_, d3nzjg_, d3nzjh_, d3nzji_, d3nzjj_, d3nzjk_, d3nzjl_, d3nzjm_, d3nzjn_, d3nzjo_, d3nzjp_, d3nzjq_, d3nzjr_, d3nzjs_, d3nzju_, d3nzjv_, d3nzjw_, d3nzjx_, d3nzjy_, d3nzjz_
    automated match to d1irug_
    complexed with mes

Details for d3nzjf_

PDB Entry: 3nzj (more details), 2.4 Å

PDB Description: Crystal structure of yeast 20S proteasome in complex with ligand 2a
PDB Compounds: (F:) Proteasome component C1

SCOPe Domain Sequences for d3nzjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nzjf_ d.153.1.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d3nzjf_:

Click to download the PDB-style file with coordinates for d3nzjf_.
(The format of our PDB-style files is described here.)

Timeline for d3nzjf_: