SCOPe 2.04: Domain d3nvvk2: 3nvv K:415-528

Lineage for d3nvvk2 (3nvv K:415-528)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families)
   automatically mapped to Pfam PF03450

5. Family d.87.2.0: automated matches [232089] (1 protein)
   not a true family

6. Protein automated matches [232090] (2 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232091] (10 PDB entries)

8. Domain d3nvvk2: 3nvv K:415-528 [239514]
   Other proteins in same PDB: d3nvva1, d3nvva2, d3nvvb1, d3nvvc1, d3nvvc2, d3nvvj1, d3nvvj2, d3nvvk1, d3nvvl1, d3nvvl2
   automated match to d3nvvb2
   complexed with ast, fad, fes, mos, mte

Details for d3nvvk2

PDB Entry: 3nvv, 1.82 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Arsenite

PDB Compounds: (K:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvvk2:

Sequence; same for both SEQRES and ATOM records:

>d3nvvk2 d.87.2.0 (K:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

Timeline for d3nvvk2:

• d3nvvk2 is new in SCOPe 2.04-stable
  
• d3nvvk2 appears in SCOPe 2.05
  
• d3nvvk2 appears in the current release, SCOPe 2.08