Lineage for d3nrza2 (3nrz A:93-165)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328387Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2328388Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2328389Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2328471Protein automated matches [232101] (1 species)
    not a true protein
  7. 2328472Species Cow (Bos taurus) [TaxId:9913] [232106] (10 PDB entries)
  8. 2328477Domain d3nrza2: 3nrz A:93-165 [239500]
    Other proteins in same PDB: d3nrza1, d3nrzb1, d3nrzb2, d3nrzc1, d3nrzc2, d3nrzj1, d3nrzk1, d3nrzk2, d3nrzl1, d3nrzl2
    automated match to d3etrl2
    complexed with fad, fes, hpa, mos, mte

Details for d3nrza2

PDB Entry: 3nrz (more details), 1.8 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Hypoxanthine
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nrza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nrza2 a.56.1.1 (A:93-165) automated matches {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOPe Domain Coordinates for d3nrza2:

Click to download the PDB-style file with coordinates for d3nrza2.
(The format of our PDB-style files is described here.)

Timeline for d3nrza2: