SCOPe 2.08: Domain d3ncxa1: 3ncx A:747-840

Lineage for d3ncxa1 (3ncx A:747-840)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.14: Invasin/intimin cell-adhesion fragments [49373] (2 families)

5. Family b.1.14.0: automated matches [231720] (1 protein)
   not a true family

6. Protein automated matches [231721] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:544404] [233003] (3 PDB entries)

8. Domain d3ncxa1: 3ncx A:747-840 [239492]
   Other proteins in same PDB: d3ncxa2, d3ncxb2
   automated match to d3ncxb1
   mutant

Details for d3ncxa1

PDB Entry: 3ncx, 2.6 Å

PDB Description: Crystal structure of EHEC O157:H7 intimin mutant

PDB Compounds: (A:) Intimin adherence protein

SCOPe Domain Sequences for d3ncxa1:

Sequence; same for both SEQRES and ATOM records:

>d3ncxa1 b.1.14.0 (A:747-840) automated matches {Escherichia coli [TaxId: 544404]}
atevtffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatv
dasgkvtlngkgsvvikatsgdkqtvsytikaps

Timeline for d3ncxa1:

• d3ncxa1 first appeared in SCOPe 2.04
  
• d3ncxa1 appears in SCOPe 2.07