SCOPe 2.06: Domain d3ncbb2: 3ncb B:101-206

Lineage for d3ncbb2 (3ncb B:101-206)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (30 PDB entries)

8. Domain d3ncbb2: 3ncb B:101-206 [239491]
   Other proteins in same PDB: d3ncba_
   automated match to d3mzgb2
   complexed with cl, co3, na; mutant

Details for d3ncbb2

PDB Entry: 3ncb, 2.1 Å

PDB Description: a mutant human prolactin receptor antagonist h180a in complex with the extracellular domain of the human prolactin receptor

PDB Compounds: (B:) Prolactin receptor

SCOPe Domain Sequences for d3ncbb2:

Sequence; same for both SEQRES and ATOM records:

>d3ncbb2 b.1.2.1 (B:101-206) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqpdpplelavevkqpedrkpylwikwspptlidlktgwftllyeirlkpekaaeweihf
agqqtefkilslhpgqkylvqvrckpdhgywsawspatfiqipsdf

Timeline for d3ncbb2:

• d3ncbb2 first appeared in SCOPe 2.04
  
• d3ncbb2 appears in SCOPe 2.05
  
• d3ncbb2 appears in SCOPe 2.07
  
• d3ncbb2 appears in the current release, SCOPe 2.08