Lineage for d3mpsi2 (3mps I:135-171)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263118Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2263360Family g.41.5.0: automated matches [232942] (1 protein)
    not a true family
  6. 2263361Protein automated matches [232943] (3 species)
    not a true protein
  7. 2263377Species Pyrococcus furiosus [TaxId:2261] [232944] (4 PDB entries)
  8. 2263396Domain d3mpsi2: 3mps I:135-171 [239485]
    Other proteins in same PDB: d3mpsa1, d3mpsb1, d3mpsd1, d3mpsf1, d3mpsg1, d3mpsh1, d3mpsi1, d3mpsk1
    automated match to d3mpsa2
    complexed with fe, feo, peo

Details for d3mpsi2

PDB Entry: 3mps (more details), 2 Å

PDB Description: peroxide bound oxidized rubrerythrin from pyrococcus furiosus
PDB Compounds: (I:) rubrerythrin

SCOPe Domain Sequences for d3mpsi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mpsi2 g.41.5.0 (I:135-171) automated matches {Pyrococcus furiosus [TaxId: 2261]}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe

SCOPe Domain Coordinates for d3mpsi2:

Click to download the PDB-style file with coordinates for d3mpsi2.
(The format of our PDB-style files is described here.)

Timeline for d3mpsi2: