Lineage for d3mpsg2 (3mps G:135-171)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2587651Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2587893Family g.41.5.0: automated matches [232942] (1 protein)
    not a true family
  6. 2587894Protein automated matches [232943] (3 species)
    not a true protein
  7. 2587910Species Pyrococcus furiosus [TaxId:2261] [232944] (4 PDB entries)
  8. 2587927Domain d3mpsg2: 3mps G:135-171 [239481]
    Other proteins in same PDB: d3mpsa1, d3mpsb1, d3mpsd1, d3mpsf1, d3mpsg1, d3mpsh1, d3mpsi1, d3mpsk1
    automated match to d3mpsa2
    complexed with fe, feo, peo

Details for d3mpsg2

PDB Entry: 3mps (more details), 2 Å

PDB Description: Peroxide Bound Oxidized Rubrerythrin from Pyrococcus furiosus
PDB Compounds: (G:) rubrerythrin

SCOPe Domain Sequences for d3mpsg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mpsg2 g.41.5.0 (G:135-171) automated matches {Pyrococcus furiosus [TaxId: 2261]}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe

SCOPe Domain Coordinates for d3mpsg2:

Click to download the PDB-style file with coordinates for d3mpsg2.
(The format of our PDB-style files is described here.)

Timeline for d3mpsg2: