Lineage for d3m6sh_ (3m6s H:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2591653Species Influenza A virus, different strains [TaxId:11320] [58067] (125 PDB entries)
  8. 2591938Domain d3m6sh_: 3m6s H: [239460]
    Other proteins in same PDB: d3m6sa1, d3m6sa2, d3m6sc1, d3m6sc2, d3m6se1, d3m6se2, d3m6sg_, d3m6si1, d3m6si2, d3m6sk_
    automated match to d4n5zb_
    complexed with nag

Details for d3m6sh_

PDB Entry: 3m6s (more details), 2.8 Å

PDB Description: Crystal structure of H1N1pdm Hemagglutinin
PDB Compounds: (H:) Hemagglutinin

SCOPe Domain Sequences for d3m6sh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m6sh_ h.3.1.1 (H:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt
qftavgkefnhlekrienlnkkiddgfldiwtynaellvllenertldyhdsnvknlyek
vrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnre

SCOPe Domain Coordinates for d3m6sh_:

Click to download the PDB-style file with coordinates for d3m6sh_.
(The format of our PDB-style files is described here.)

Timeline for d3m6sh_: