| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
| Family d.185.1.0: automated matches [232765] (1 protein) not a true family |
| Protein automated matches [232766] (2 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries) |
| Domain d3l75n1: 3l75 N:3-233 [239400] Other proteins in same PDB: d3l75c1, d3l75c2, d3l75d1, d3l75d2, d3l75f_, d3l75g_, d3l75h_, d3l75j_, d3l75p1, d3l75p2, d3l75q1, d3l75q2, d3l75s_, d3l75t_, d3l75u_, d3l75w_ automated match to d3l71a1 complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq |
PDB Entry: 3l75 (more details), 2.79 Å
SCOPe Domain Sequences for d3l75n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l75n1 d.185.1.0 (N:3-233) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tyaqtlqnipetnvttldnglrvaseessqptctvgvwigagsryeneknngagyfvehl
afkgtkkrpcaafekevesmgahfngytsreqtafyikalskdmpkvvelladvvqncal
eesqiekergvilqelkemdndmtnvtfdylhatafqgtalartvegttenikhltradl
asyidthfkaprmvlaaaggishkelvdaarqhfsgvsftykedavpilpr
Timeline for d3l75n1: