Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.0: automated matches [232765] (1 protein) not a true family |
Protein automated matches [232766] (2 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries) |
Domain d3l74o1: 3l74 O:18-235 [239390] Other proteins in same PDB: d3l74c1, d3l74c2, d3l74d1, d3l74d2, d3l74e1, d3l74e2, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74p1, d3l74p2, d3l74q1, d3l74q2, d3l74r1, d3l74r2, d3l74s_, d3l74t_, d3l74u_, d3l74w_ automated match to d3l70o1 complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq |
PDB Entry: 3l74 (more details), 2.76 Å
SCOPe Domain Sequences for d3l74o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l74o1 d.185.1.0 (O:18-235) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} cpgaedleitklpngliiaslenfspasrigvfikagsryettanlgtahllrlaspltt kgassfritrgieavggslsvystrekmtycveclrdhvdtvmeyllnvttapefrpwev tdlqpqlkvdkavafqspqvgvlenlhaaayktalanplycpdyrigkitseqlhhfvqn nftsarmalvgigvkhsdlkqvaeqflnirsgagtssa
Timeline for d3l74o1:
View in 3D Domains from other chains: (mouse over for more information) d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74c1, d3l74c2, d3l74d1, d3l74d2, d3l74e1, d3l74e2, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74n1, d3l74n2, d3l74p1, d3l74p2, d3l74q1, d3l74q2, d3l74r1, d3l74r2, d3l74s_, d3l74t_, d3l74u_, d3l74w_ |