Lineage for d3l74n2 (3l74 N:234-444)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237726Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2237727Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2238011Family d.185.1.0: automated matches [232765] (1 protein)
    not a true family
  6. 2238012Protein automated matches [232766] (2 species)
    not a true protein
  7. 2238013Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries)
  8. 2238043Domain d3l74n2: 3l74 N:234-444 [239389]
    Other proteins in same PDB: d3l74c1, d3l74c2, d3l74d1, d3l74d2, d3l74e1, d3l74e2, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74p1, d3l74p2, d3l74q1, d3l74q2, d3l74r1, d3l74r2, d3l74s_, d3l74t_, d3l74u_, d3l74w_
    automated match to d3l71a2
    complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq

Details for d3l74n2

PDB Entry: 3l74 (more details), 2.76 Å

PDB Description: cytochrome bc1 complex from chicken with famoxadone bound
PDB Compounds: (N:) Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i

SCOPe Domain Sequences for d3l74n2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l74n2 d.185.1.0 (N:234-444) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
crftgseirarddalpvahvalavegpgwadpdnvvlhvanaiigrydrtfgggkhlssr
laalavehklchsfqtfntsysdtglfgfhfvadplsiddmmfcaqgewmrlctsttese
vkraknhlrsamvaqldgttpvcetigshllnygrrisleewdsrisavdarmvrdvcsk
yiydkcpalaavgpieqlldynrirsgmywi

SCOPe Domain Coordinates for d3l74n2:

Click to download the PDB-style file with coordinates for d3l74n2.
(The format of our PDB-style files is described here.)

Timeline for d3l74n2: