Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins) |
Protein automated matches [232767] (3 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [232780] (8 PDB entries) |
Domain d3l74d1: 3l74 D:1-195 [239386] Other proteins in same PDB: d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74c1, d3l74c2, d3l74d2, d3l74e1, d3l74e2, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74n1, d3l74n2, d3l74o1, d3l74o2, d3l74p1, d3l74p2, d3l74q2, d3l74r1, d3l74r2, d3l74s_, d3l74t_, d3l74u_, d3l74w_ automated match to d3l70d1 complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq |
PDB Entry: 3l74 (more details), 2.76 Å
SCOPe Domain Sequences for d3l74d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l74d1 a.3.1.3 (D:1-195) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} gelelhppafpwshggplsaldhssvrrgfqvykqvcsachsmdyvafrnligvthteae akalaeevevqdgpdengelfmrpgkisdyfpkpypnpeaaraanngalppdlsyivnar hggedyvfslltgycdppagvvvreglhynpyfpgqaigmappiyneileyddgtpatms qiakdvctflrwaae
Timeline for d3l74d1:
View in 3D Domains from other chains: (mouse over for more information) d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74c1, d3l74c2, d3l74e1, d3l74e2, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74n1, d3l74n2, d3l74o1, d3l74o2, d3l74p1, d3l74p2, d3l74q1, d3l74q2, d3l74r1, d3l74r2, d3l74s_, d3l74t_, d3l74u_, d3l74w_ |