![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) ![]() |
![]() | Family f.23.11.0: automated matches [232790] (1 protein) not a true family |
![]() | Protein automated matches [232791] (3 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [232792] (8 PDB entries) |
![]() | Domain d3l71q2: 3l71 Q:196-241 [239381] Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d1, d3l71e1, d3l71e2, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q1, d3l71r1, d3l71r2, d3l71s_, d3l71t_, d3l71u_, d3l71w_ automated match to d3l70d2 complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq |
PDB Entry: 3l71 (more details), 2.84 Å
SCOPe Domain Sequences for d3l71q2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l71q2 f.23.11.0 (Q:196-241) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} pehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrppk
Timeline for d3l71q2: