SCOPe 2.04: Domain d3l71q2: 3l71 Q:196-241

Lineage for d3l71q2 (3l71 Q:196-241)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families)

5. Family f.23.11.0: automated matches [232790] (1 protein)
   not a true family

6. Protein automated matches [232791] (3 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [232792] (8 PDB entries)

8. Domain d3l71q2: 3l71 Q:196-241 [239381]
   Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d1, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q1, d3l71s_, d3l71t_, d3l71u_, d3l71w_
   automated match to d3l70d2
   complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71q2

PDB Entry: 3l71, 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound

PDB Compounds: (Q:) Mitochondrial cytochrome c1, heme protein

SCOPe Domain Sequences for d3l71q2:

Sequence; same for both SEQRES and ATOM records:

>d3l71q2 f.23.11.0 (Q:196-241) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
pehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrppk

Timeline for d3l71q2:

• d3l71q2 is new in SCOPe 2.04-stable
  
• d3l71q2 appears in SCOPe 2.05
  
• d3l71q2 appears in the current release, SCOPe 2.08