Lineage for d3l71q1 (3l71 Q:1-195)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691442Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 2691486Protein automated matches [232767] (3 species)
    not a true protein
  7. 2691491Species Chicken (Gallus gallus) [TaxId:9031] [232780] (8 PDB entries)
  8. 2691499Domain d3l71q1: 3l71 Q:1-195 [239380]
    Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d2, d3l71e1, d3l71e2, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q2, d3l71r1, d3l71r2, d3l71s_, d3l71t_, d3l71u_, d3l71w_
    automated match to d3l70d1
    complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71q1

PDB Entry: 3l71 (more details), 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound
PDB Compounds: (Q:) Mitochondrial cytochrome c1, heme protein

SCOPe Domain Sequences for d3l71q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l71q1 a.3.1.3 (Q:1-195) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gelelhppafpwshggplsaldhssvrrgfqvykqvcsachsmdyvafrnligvthteae
akalaeevevqdgpdengelfmrpgkisdyfpkpypnpeaaraanngalppdlsyivnar
hggedyvfslltgycdppagvvvreglhynpyfpgqaigmappiyneileyddgtpatms
qiakdvctflrwaae

SCOPe Domain Coordinates for d3l71q1:

Click to download the PDB-style file with coordinates for d3l71q1.
(The format of our PDB-style files is described here.)

Timeline for d3l71q1: