SCOPe 2.08: Domain d3l71q1: 3l71 Q:1-195

Lineage for d3l71q1 (3l71 Q:1-195)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)

6. Protein automated matches [232767] (3 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [232780] (8 PDB entries)

8. Domain d3l71q1: 3l71 Q:1-195 [239380]
   Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d2, d3l71e1, d3l71e2, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q2, d3l71r1, d3l71r2, d3l71s_, d3l71t_, d3l71u_, d3l71w_
   automated match to d3l70d1
   complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71q1

PDB Entry: 3l71, 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound

PDB Compounds: (Q:) Mitochondrial cytochrome c1, heme protein

SCOPe Domain Sequences for d3l71q1:

Sequence; same for both SEQRES and ATOM records:

>d3l71q1 a.3.1.3 (Q:1-195) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gelelhppafpwshggplsaldhssvrrgfqvykqvcsachsmdyvafrnligvthteae
akalaeevevqdgpdengelfmrpgkisdyfpkpypnpeaaraanngalppdlsyivnar
hggedyvfslltgycdppagvvvreglhynpyfpgqaigmappiyneileyddgtpatms
qiakdvctflrwaae

Timeline for d3l71q1:

• d3l71q1 first appeared in SCOPe 2.04
  
• d3l71q1 appears in SCOPe 2.07