Lineage for d3hbvp2 (3hbv P:61-258)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205315Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 2205316Protein Metalloprotease [55509] (4 species)
    the rest of protein is all-beta sandwich containing a parallel beta-helix
  7. 2205317Species Erwinia chrysanthemi [TaxId:556] [82735] (9 PDB entries)
    Protease C
  8. 2205321Domain d3hbvp2: 3hbv P:61-258 [239338]
    Other proteins in same PDB: d3hbvp1
    complexed with ca, cl, zn; mutant

Details for d3hbvp2

PDB Entry: 3hbv (more details), 1.95 Å

PDB Description: prtc methionine mutants: m226a in-house
PDB Compounds: (P:) secreted protease C

SCOPe Domain Sequences for d3hbvp2:

Sequence, based on SEQRES records: (download)

>d3hbvp2 d.92.1.6 (P:61-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]}
nvswngtnvfgksanltfkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltf
tevtgnksanitfgnytrdasgnldygtqayayypgnyqgagsswynynqsnirnpgsee
ygrqtftheighalglahpgeynagegdpsyndavyaedsyqfsiasywgenetgadyng
hyggapmiddiaaiqrly

Sequence, based on observed residues (ATOM records): (download)

>d3hbvp2 d.92.1.6 (P:61-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]}
nvswngtnvfgksanltfkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltf
tevtgnksanitfgnytrdasgnldygtqayayypgnyqgagsswynynqsnirnpgsee
ygrqtftheighalglahynghyggapmiddiaaiqrly

SCOPe Domain Coordinates for d3hbvp2:

Click to download the PDB-style file with coordinates for d3hbvp2.
(The format of our PDB-style files is described here.)

Timeline for d3hbvp2: