SCOPe 2.04: Domain d3hbvp2: 3hbv P:61-258

Lineage for d3hbvp2 (3hbv P:61-258)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
   characteristic HEXXHXXGXXH motif and Met located near C-terminus

6. Protein Metalloprotease [55509] (4 species)
   the rest of protein is all-beta sandwich containing a parallel beta-helix

7. Species Erwinia chrysanthemi [TaxId:556] [82735] (9 PDB entries)
   Protease C

8. Domain d3hbvp2: 3hbv P:61-258 [239338]
   Other proteins in same PDB: d3hbvp1
   complexed with ca, cl, zn; mutant

Details for d3hbvp2

PDB Entry: 3hbv, 1.95 Å

PDB Description: prtc methionine mutants: m226a in-house

PDB Compounds: (P:) secreted protease C

SCOPe Domain Sequences for d3hbvp2:

Sequence, based on SEQRES records:

>d3hbvp2 d.92.1.6 (P:61-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]}
nvswngtnvfgksanltfkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltf
tevtgnksanitfgnytrdasgnldygtqayayypgnyqgagsswynynqsnirnpgsee
ygrqtftheighalglahpgeynagegdpsyndavyaedsyqfsiasywgenetgadyng
hyggapmiddiaaiqrly

Sequence, based on observed residues (ATOM records):

>d3hbvp2 d.92.1.6 (P:61-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]}
nvswngtnvfgksanltfkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltf
tevtgnksanitfgnytrdasgnldygtqayayypgnyqgagsswynynqsnirnpgsee
ygrqtftheighalglahynghyggapmiddiaaiqrly

Timeline for d3hbvp2:

• d3hbvp2 is new in SCOPe 2.04-stable
  
• d3hbvp2 appears in SCOPe 2.05
  
• d3hbvp2 appears in the current release, SCOPe 2.08