SCOPe 2.08: Domain d3h4el1: 3h4e L:1-147

Lineage for d3h4el1 (3h4e L:1-147)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein automated matches [190369] (8 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [232370] (2 PDB entries)

8. Domain d3h4el1: 3h4e L:1-147 [239335]
   Other proteins in same PDB: d3h4ea2, d3h4eb2, d3h4ec2, d3h4ed2, d3h4ee2, d3h4ef2, d3h4eg2, d3h4eh2, d3h4ei2, d3h4ej2, d3h4ek2, d3h4el2
   automated match to d3h47a1

Details for d3h4el1

PDB Entry: 3h4e, 2.7 Å

PDB Description: x-ray structure of hexameric hiv-1 ca

PDB Compounds: (L:) capsid protein p24

SCOPe Domain Sequences for d3h4el1:

Sequence, based on SEQRES records:

>d3h4el1 a.73.1.1 (L:1-147) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records):

>d3h4el1 a.73.1.1 (L:1-147) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhprgsdiagttstlqeqigwmthnppipvgeiykrwi
ilglnkivrmysp

Timeline for d3h4el1:

• d3h4el1 first appeared in SCOPe 2.04
  
• d3h4el1 appears in SCOPe 2.07