SCOPe 2.04: Domain d3gzya2: 3gzy A:179-457

Lineage for d3gzya2 (3gzy A:179-457)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (19 species)
   not a true protein

7. Species Comamonas testosteroni [TaxId:285] [232354] (2 PDB entries)

8. Domain d3gzya2: 3gzy A:179-457 [239332]
   Other proteins in same PDB: d3gzya1, d3gzyb_
   automated match to d3gzxa2
   complexed with fe2, fes, mes

Details for d3gzya2

PDB Entry: 3gzy, 1.62 Å

PDB Description: Crystal Structure of the Biphenyl Dioxygenase from Comamonas testosteroni Sp. Strain B-356

PDB Compounds: (A:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d3gzya2:

Sequence; same for both SEQRES and ATOM records:

>d3gzya2 d.129.3.0 (A:179-457) automated matches {Comamonas testosteroni [TaxId: 285]}
eapdlktylsdampymdvmldrteagteaiggiqkwvipcnwkfaaeqfcsdmyhagtms
hlsgvlaglppemdltqiqlskngnqfrsawgghgagwfindssillsvvgpkitqywtq
gpaaekaarrvpqlpildmfgqhmtvfptcsflpgintirtwhprgpnevevwafvlvda
dapedikeefrlqnirtfnaggvfeqddgenwveiqrvmrghkakstslcakmglnvpnk
nnpaypgktayvyaeeaargmyhhwsrmmsepswdtlkp

Timeline for d3gzya2:

• d3gzya2 is new in SCOPe 2.04-stable
  
• d3gzya2 appears in SCOPe 2.05
  
• d3gzya2 appears in the current release, SCOPe 2.08