SCOPe 2.08: Domain d3gzya1: 3gzy A:18-178

Lineage for d3gzya1 (3gzy A:18-178)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (13 species)
   not a true protein

7. Species Comamonas testosteroni [TaxId:285] [232352] (2 PDB entries)

8. Domain d3gzya1: 3gzy A:18-178 [239331]
   Other proteins in same PDB: d3gzya2, d3gzyb_
   automated match to d3gzxa1
   complexed with fe2, fes, mes

Details for d3gzya1

PDB Entry: 3gzy, 1.62 Å

PDB Description: Crystal Structure of the Biphenyl Dioxygenase from Comamonas testosteroni Sp. Strain B-356

PDB Compounds: (A:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d3gzya1:

Sequence; same for both SEQRES and ATOM records:

>d3gzya1 b.33.1.0 (A:18-178) automated matches {Comamonas testosteroni [TaxId: 285]}
nwtpdairalvdqdngkldariyadqdlyqlelervfgrswlmlghethipkigdyltty
mgedpvimvrqkdqsikvflnqcrhrgmrivrsdggnakaftctyhgwaydiagnlvnvp
fekeafcdkkegdcgfdkadwgplqarvetykglvfanwdp

Timeline for d3gzya1:

• d3gzya1 first appeared in SCOPe 2.04
  
• d3gzya1 appears in SCOPe 2.07