Lineage for d3gzya1 (3gzy A:18-178)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782562Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2782563Protein automated matches [190701] (13 species)
    not a true protein
  7. 2782646Species Comamonas testosteroni [TaxId:285] [232352] (2 PDB entries)
  8. 2782647Domain d3gzya1: 3gzy A:18-178 [239331]
    Other proteins in same PDB: d3gzya2, d3gzyb_
    automated match to d3gzxa1
    complexed with fe2, fes, mes

Details for d3gzya1

PDB Entry: 3gzy (more details), 1.62 Å

PDB Description: Crystal Structure of the Biphenyl Dioxygenase from Comamonas testosteroni Sp. Strain B-356
PDB Compounds: (A:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d3gzya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gzya1 b.33.1.0 (A:18-178) automated matches {Comamonas testosteroni [TaxId: 285]}
nwtpdairalvdqdngkldariyadqdlyqlelervfgrswlmlghethipkigdyltty
mgedpvimvrqkdqsikvflnqcrhrgmrivrsdggnakaftctyhgwaydiagnlvnvp
fekeafcdkkegdcgfdkadwgplqarvetykglvfanwdp

SCOPe Domain Coordinates for d3gzya1:

Click to download the PDB-style file with coordinates for d3gzya1.
(The format of our PDB-style files is described here.)

Timeline for d3gzya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gzya2
View in 3D
Domains from other chains:
(mouse over for more information)
d3gzyb_