SCOPe 2.08: Domain d3gwaa2: 3gwa A:185-344

Lineage for d3gwaa2 (3gwa A:185-344)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [232341] (2 PDB entries)

8. Domain d3gwaa2: 3gwa A:185-344 [239328]

Details for d3gwaa2

PDB Entry: 3gwa, 1.6 Å

PDB Description: 1.6 Angstrom crystal structure of 3-oxoacyl-(acyl-carrier-protein) synthase III

PDB Compounds: (A:) 3-oxoacyl-(Acyl-carrier-protein) synthase III

SCOPe Domain Sequences for d3gwaa2:

Sequence; same for both SEQRES and ATOM records:

>d3gwaa2 c.95.1.0 (A:185-344) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
igpfvfgtdgrgapnlivkaglfrepksadsarehedasgnvrtdehlymngaevmafsl
aevpraadrllalageprenidcfvlhqanrfmldalrkkmkipehkfpvlmehcgntvs
stlplaletmrangtlargmrlmllgfgvgyswagclvnf

Timeline for d3gwaa2:

• d3gwaa2 first appeared in SCOPe 2.04
  
• d3gwaa2 appears in SCOPe 2.07