Lineage for d3gqib2 (3gqi B:659-770)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965563Protein Phospholipase C-gamma-1 [55577] (2 species)
  7. 2965571Species Norway rat (Rattus norvegicus) [TaxId:10116] [226824] (3 PDB entries)
  8. 2965575Domain d3gqib2: 3gqi B:659-770 [239326]
    Other proteins in same PDB: d3gqia_
    automated match to d1qada_
    complexed with acp, dvt, mg

Details for d3gqib2

PDB Entry: 3gqi (more details), 2.5 Å

PDB Description: crystal structure of activated receptor tyrosine kinase in complex with substrates
PDB Compounds: (B:) Phospholipase C-gamma-1

SCOPe Domain Sequences for d3gqib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gqib2 d.93.1.1 (B:659-770) Phospholipase C-gamma-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qtnaheskewyhasltraqaehmlmrvprdgaflvrkrnepnsyaisfraegkikhcrvq
qegqtvmlgnsefdslvdlisyyekhplyrkmklrypineealekigtaepd

SCOPe Domain Coordinates for d3gqib2:

Click to download the PDB-style file with coordinates for d3gqib2.
(The format of our PDB-style files is described here.)

Timeline for d3gqib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gqib1
View in 3D
Domains from other chains:
(mouse over for more information)
d3gqia_