Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (12 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries) |
Domain d3gbmb1: 3gbm B:1-174 [239293] Other proteins in same PDB: d3gbma1, d3gbma2, d3gbmb2, d3gbmc1, d3gbmc2, d3gbml1, d3gbml2, d3gbmm1, d3gbmm2 automated match to d4n5zb_ complexed with bma, edo, gol, nag |
PDB Entry: 3gbm (more details), 2.7 Å
SCOPe Domain Sequences for d3gbmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gbmb1 h.3.1.1 (B:1-174) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeis
Timeline for d3gbmb1: