SCOPe 2.05: Domain d3fzla1: 3fzl A:5-188

Lineage for d3fzla1 (3fzl A:5-188)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (42 PDB entries)

8. Domain d3fzla1: 3fzl A:5-188 [239287]
   Other proteins in same PDB: d3fzlb_
   automated match to d3fzfa1
   complexed with 3fd, trs

Details for d3fzla1

PDB Entry: 3fzl, 2.2 Å

PDB Description: Crystal Structures of Hsc70/Bag1 in Complex with Small Molecule Inhibitors

PDB Compounds: (A:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d3fzla1:

Sequence; same for both SEQRES and ATOM records:

>d3fzla1 c.55.1.0 (A:5-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnpt
ntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmvl
tkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiayg
ldkk

Timeline for d3fzla1:

• d3fzla1 first appeared in SCOPe 2.04
  
• d3fzla1 appears in SCOPe 2.06
  
• d3fzla1 appears in the current release, SCOPe 2.08