Lineage for d3fyid2 (3fyi D:130-281)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043698Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2043699Protein Cytochrome c oxidase [49544] (4 species)
  7. 2043774Species Rhodobacter sphaeroides [TaxId:1063] [74870] (6 PDB entries)
  8. 2043782Domain d3fyid2: 3fyi D:130-281 [239284]
    Other proteins in same PDB: d3fyia_, d3fyib1, d3fyib3, d3fyic_, d3fyid1, d3fyid3
    automated match to d3fyeb2
    complexed with ca, cd, cu1, cyn, dmu, hea, hto, mg, trd

Details for d3fyid2

PDB Entry: 3fyi (more details), 2.2 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides in the reduced state bound with cyanide
PDB Compounds: (D:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3fyid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fyid2 b.6.1.2 (D:130-281) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleq

SCOPe Domain Coordinates for d3fyid2:

Click to download the PDB-style file with coordinates for d3fyid2.
(The format of our PDB-style files is described here.)

Timeline for d3fyid2: