SCOPe 2.04: Domain d3fyib2: 3fyi B:130-285

Lineage for d3fyib2 (3fyi B:130-285)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [74870] (6 PDB entries)

8. Domain d3fyib2: 3fyi B:130-285 [239282]
   Other proteins in same PDB: d3fyia_, d3fyib1, d3fyic_, d3fyid1
   automated match to d3fyeb2
   complexed with ca, cd, cu1, cyn, dmu, hea, hto, mg, trd

Details for d3fyib2

PDB Entry: 3fyi, 2.2 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides in the reduced state bound with cyanide

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3fyib2:

Sequence; same for both SEQRES and ATOM records:

>d3fyib2 b.6.1.2 (B:130-285) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleqhhhh

Timeline for d3fyib2:

• d3fyib2 is new in SCOPe 2.04-stable
  
• d3fyib2 appears in SCOPe 2.05
  
• d3fyib2 appears in the current release, SCOPe 2.08