Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
Protein Cytochrome c oxidase [49544] (4 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [74870] (7 PDB entries) |
Domain d3fyib2: 3fyi B:130-281 [239282] Other proteins in same PDB: d3fyia_, d3fyib1, d3fyib3, d3fyic_, d3fyid1, d3fyid3 automated match to d3fyeb2 complexed with ca, cd, cu1, cyn, dmu, hea, hto, mg, trd |
PDB Entry: 3fyi (more details), 2.2 Å
SCOPe Domain Sequences for d3fyib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fyib2 b.6.1.2 (B:130-281) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]} peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff gqcselcgishaympitvkvvseeayaawleq
Timeline for d3fyib2: