Lineage for d3fyed1 (3fye D:30-129)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3024004Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 3024005Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 3024006Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)
  7. 3024012Species Rhodobacter sphaeroides [TaxId:1063] [81457] (7 PDB entries)
  8. 3024022Domain d3fyed1: 3fye D:30-129 [239279]
    Other proteins in same PDB: d3fyea_, d3fyeb2, d3fyeb3, d3fyec_, d3fyed2, d3fyed3
    automated match to d3fyeb1
    complexed with ca, cd, cu1, dmu, hea, hto, mg, trd, unx

Details for d3fyed1

PDB Entry: 3fye (more details), 2.15 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides in the reduced state
PDB Compounds: (D:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3fyed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fyed1 f.17.2.1 (D:30-129) Bacterial aa3 type cytochrome c oxidase subunit II {Rhodobacter sphaeroides [TaxId: 1063]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

SCOPe Domain Coordinates for d3fyed1:

Click to download the PDB-style file with coordinates for d3fyed1.
(The format of our PDB-style files is described here.)

Timeline for d3fyed1: