Lineage for d3feyc_ (3fey C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1500528Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1501071Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 1501072Protein automated matches [190220] (10 species)
    not a true protein
  7. 1501096Species Human (Homo sapiens) [TaxId:9606] [189070] (23 PDB entries)
  8. 1501100Domain d3feyc_: 3fey C: [239278]
    Other proteins in same PDB: d3feyb_
    automated match to d1un0b_
    protein/RNA complex

Details for d3feyc_

PDB Entry: 3fey (more details), 2.2 Å

PDB Description: Crystal structure of the CBC-importin alpha complex.
PDB Compounds: (C:) Importin subunit alpha-2

SCOPe Domain Sequences for d3feyc_:

Sequence, based on SEQRES records: (download)

>d3feyc_ a.118.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mnqgtvnwsvddivkginssnvenqlqatqaarkllsrekqppidniiraglipkfvsfl
grtdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgn
iagdgsvfrdlvikygavdpllallavpdmsslacgylrnltwtlsnlcrnknpappida
veqilptlvrllhhddpevladtcwaisyltdgpnerigmvvktgvvpqlvkllgaselp
ivtpalraignivtgtdeqtqvvidagalavfpslltnpktniqkeatwtmsnitagrqd
qiqqvvnhglvpflvsvlskadfktqkeavwavtnytsggtveqivylvhcgiieplmnl
ltakdtkiilvildaisnifqaaeklgeteklsimieecggldkiealqnhenesvykas
lsliekyfsve

Sequence, based on observed residues (ATOM records): (download)

>d3feyc_ a.118.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mnqgtvnwsvddivkginssnvenqlqatqaarkllsrekqppidniiraglipkfvsfl
grtdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgn
iagdgsvfrdlvikygavdpllallavsslacgylrnltwtlsnlcrnknpappidaveq
ilptlvrllhhddpevladtcwaisyltdgpnerigmvvktgvvpqlvkllgaselpivt
palraignivtgtdeqtqvvidagalavfpslltnpktniqkeatwtmsnitagrqdqiq
qvvnhglvpflvsvlskadfktqkeavwavtnytsggtveqivylvhcgiieplmnllta
kdtkiilvildaisnifqaaeklgeteklsimieecggldkiealqnhenesvykaslsl
iekyfsve

SCOPe Domain Coordinates for d3feyc_:

Click to download the PDB-style file with coordinates for d3feyc_.
(The format of our PDB-style files is described here.)

Timeline for d3feyc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3feyb_