SCOPe 2.04: Domain d3f7pc2: 3f7p C:1218-1330

Lineage for d3f7pc2 (3f7p C:1218-1330)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Integrin beta-4 subunit [49278] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49279] (3 PDB entries)

8. Domain d3f7pc2: 3f7p C:1218-1330 [239271]
   Other proteins in same PDB: d3f7pa1, d3f7pa2, d3f7pb1, d3f7pb2
   automated match to d1qg3a2
   complexed with ca, edo, peg

Details for d3f7pc2

PDB Entry: 3f7p, 2.75 Å

PDB Description: Crystal structure of a complex between integrin beta4 and plectin

PDB Compounds: (C:) Integrin beta-4

SCOPe Domain Sequences for d3f7pc2:

Sequence, based on SEQRES records:

>d3f7pc2 b.1.2.1 (C:1218-1330) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}
evpsepgrlafnvvsstvtqlswaepaetngeitayevcyglvnddnrpigpmkkvlvdn
pknrmllienlresqpyrytvkarngagwgpereaiinlatqpkrpmsipiip

Sequence, based on observed residues (ATOM records):

>d3f7pc2 b.1.2.1 (C:1218-1330) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}
evpsepgrlafnvvsstvtqlswaepaetngeitayevcyglvnddnrpigpmkkvlvdn
pknrmllienlresqpyrytvkarngagwgpereaiinlatqmsipiip

Timeline for d3f7pc2:

• d3f7pc2 is new in SCOPe 2.04-stable
  
• d3f7pc2 appears in SCOPe 2.05
  
• d3f7pc2 appears in the current release, SCOPe 2.08