Lineage for d3f7pc1 (3f7p C:1127-1217)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1767526Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1767806Protein Integrin beta-4 subunit [49278] (1 species)
  7. 1767807Species Human (Homo sapiens) [TaxId:9606] [49279] (3 PDB entries)
  8. 1767812Domain d3f7pc1: 3f7p C:1127-1217 [239270]
    Other proteins in same PDB: d3f7pa1, d3f7pa2, d3f7pb1, d3f7pb2
    automated match to d1qg3a1
    complexed with ca, edo, peg

Details for d3f7pc1

PDB Entry: 3f7p (more details), 2.75 Å

PDB Description: Crystal structure of a complex between integrin beta4 and plectin
PDB Compounds: (C:) Integrin beta-4

SCOPe Domain Sequences for d3f7pc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f7pc1 b.1.2.1 (C:1127-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}
lgapqnpnakaagsrkihfnwlppsgkpmgyrvkywiqgdseseahlldskvpsveltnl
ypycdyemkvcaygaqgegpysslvscrthq

SCOPe Domain Coordinates for d3f7pc1:

Click to download the PDB-style file with coordinates for d3f7pc1.
(The format of our PDB-style files is described here.)

Timeline for d3f7pc1: