SCOPe 2.06: Domain d3eymb_: 3eym B:

Lineage for d3eymb_ (3eym B:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (12 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)

8. Domain d3eymb_: 3eym B: [239267]
   Other proteins in same PDB: d3eyma_, d3eymc_, d3eyme_
   automated match to d1qfub_
   complexed with eyk

Details for d3eymb_

PDB Entry: 3eym, 2.8 Å

PDB Description: Structure of Influenza Haemagglutinin in complex with an inhibitor of membrane fusion

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d3eymb_:

Sequence; same for both SEQRES and ATOM records:

>d3eymb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq

Timeline for d3eymb_:

• d3eymb_ first appeared in SCOPe 2.04
  
• d3eymb_ appears in SCOPe 2.05
  
• d3eymb_ appears in SCOPe 2.07
  
• d3eymb_ appears in the current release, SCOPe 2.08