Lineage for d3eubk2 (3eub K:415-527)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569462Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2569625Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2569685Family d.87.2.0: automated matches [232089] (1 protein)
    not a true family
  6. 2569686Protein automated matches [232090] (5 species)
    not a true protein
  7. 2569687Species Cow (Bos taurus) [TaxId:9913] [232091] (11 PDB entries)
  8. 2569710Domain d3eubk2: 3eub K:415-527 [239255]
    Other proteins in same PDB: d3eub21, d3eub22, d3eub31, d3eub41, d3eub42, d3euba1, d3euba2, d3eubb1, d3eubc1, d3eubc2, d3eubj1, d3eubj2, d3eubk1, d3eubl1, d3eubl2, d3eubs1, d3eubs2, d3eubt1, d3eubu1, d3eubu2
    automated match to d3eub32
    complexed with fad, fes, mom, mte, xan

Details for d3eubk2

PDB Entry: 3eub (more details), 2.6 Å

PDB Description: Crystal Structure of Desulfo-Xanthine Oxidase with Xanthine
PDB Compounds: (K:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3eubk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eubk2 d.87.2.0 (K:415-527) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkkl

SCOPe Domain Coordinates for d3eubk2:

Click to download the PDB-style file with coordinates for d3eubk2.
(The format of our PDB-style files is described here.)

Timeline for d3eubk2: