![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
![]() | Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) ![]() |
![]() | Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
![]() | Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [81437] (29 PDB entries) |
![]() | Domain d3eh4a_: 3eh4 A: [239244] Other proteins in same PDB: d3eh4b1, d3eh4b2, d3eh4c_ automated match to d1xmea_ complexed with bng, cu1, cua, has, hem |
PDB Entry: 3eh4 (more details), 2.9 Å
SCOPe Domain Sequences for d3eh4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eh4a_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]} seisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsy yqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpll aneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtym avvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpaya iiytilpkqaggrlvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfv avpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggiv nasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavv wlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfi yglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygpt lvqlfghlnpvpgwrlw
Timeline for d3eh4a_: