SCOPe 2.04: Domain d3e6me_: 3e6m E:

Lineage for d3e6me_ (3e6m E:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (52 species)
   not a true protein

7. Species Silicibacter pomeroyi [TaxId:89184] [232048] (1 PDB entry)

8. Domain d3e6me_: 3e6m E: [239240]
   automated match to d3e6ma_

Details for d3e6me_

PDB Entry: 3e6m, 2.2 Å

PDB Description: The crystal structure of a MarR family transcriptional regulator from Silicibacter pomeroyi DSS.

PDB Compounds: (E:) MarR family Transcriptional regulator

SCOPe Domain Sequences for d3e6me_:

Sequence, based on SEQRES records:

>d3e6me_ a.4.5.0 (E:) automated matches {Silicibacter pomeroyi [TaxId: 89184]}
pkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltv
gqlatlgvmeqsttsrtvdqlvdeglaarsisdadqrkrtvvltrkgkkklaeisplind
fhaelvgnvdpdklqtcievlgeilkgktdy

Sequence, based on observed residues (ATOM records):

>d3e6me_ a.4.5.0 (E:) automated matches {Silicibacter pomeroyi [TaxId: 89184]}
pkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltv
gqlatlgvmeqsttsrtvdqlvdeglaarsisrkrtvvltrkgkkklaeisplindfhae
lvgnvdpdklqtcievlgeilkgktdy

Timeline for d3e6me_:

• d3e6me_ is new in SCOPe 2.04-stable
  
• d3e6me_ appears in SCOPe 2.05
  
• d3e6me_ appears in the current release, SCOPe 2.08