Lineage for d3dv0j_ (3dv0 J:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482050Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 1482051Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) (S)
  5. 1482080Family a.9.1.0: automated matches [191674] (1 protein)
    not a true family
  6. 1482081Protein automated matches [191291] (3 species)
    not a true protein
  7. 1482082Species Bacillus stearothermophilus [TaxId:1422] [255802] (3 PDB entries)
  8. 1482086Domain d3dv0j_: 3dv0 J: [239222]
    Other proteins in same PDB: d3dv0a_, d3dv0b1, d3dv0b2, d3dv0c_, d3dv0d1, d3dv0d2, d3dv0e_, d3dv0f1, d3dv0f2, d3dv0g_, d3dv0h1, d3dv0h2
    automated match to d1w3da_
    complexed with k, mg, pyr, tpw

Details for d3dv0j_

PDB Entry: 3dv0 (more details), 2.5 Å

PDB Description: Snapshots of catalysis in the E1 subunit of the pyruvate dehydrogenase multi-enzyme complex
PDB Compounds: (J:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

SCOPe Domain Sequences for d3dv0j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dv0j_ a.9.1.0 (J:) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
viampsvrkyarekgvdirlvqgtgkngrvlkedidaflag

SCOPe Domain Coordinates for d3dv0j_:

Click to download the PDB-style file with coordinates for d3dv0j_.
(The format of our PDB-style files is described here.)

Timeline for d3dv0j_: