Class a: All alpha proteins [46456] (285 folds) |
Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily) 3 helices; bundle, closed, right-handed twist; up-and-down |
Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) |
Family a.9.1.0: automated matches [191674] (1 protein) not a true family |
Protein automated matches [191291] (3 species) not a true protein |
Species Bacillus stearothermophilus [TaxId:1422] [255802] (3 PDB entries) |
Domain d3dufj_: 3duf J: [239220] Other proteins in same PDB: d3dufa_, d3dufb1, d3dufb2, d3dufc_, d3dufd1, d3dufd2, d3dufe_, d3duff1, d3duff2, d3dufg_, d3dufh1, d3dufh2 automated match to d1w3da_ complexed with k, mg, r1t |
PDB Entry: 3duf (more details), 2.5 Å
SCOPe Domain Sequences for d3dufj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dufj_ a.9.1.0 (J:) automated matches {Bacillus stearothermophilus [TaxId: 1422]} iampsvrkyarekgvdirlvqgtgkngrvlkedida
Timeline for d3dufj_: