Lineage for d3dtgb_ (3dtg B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953348Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 1953349Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 1953446Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 1953447Protein automated matches [190815] (10 species)
    not a true protein
  7. 1953475Species Mycobacterium smegmatis [TaxId:246196] [232034] (2 PDB entries)
  8. 1953476Domain d3dtgb_: 3dtg B: [239218]
    automated match to d3dtfa_
    complexed with gol, obz, plp

Details for d3dtgb_

PDB Entry: 3dtg (more details), 1.9 Å

PDB Description: structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design
PDB Compounds: (B:) branched-chain amino acid aminotransferase

SCOPe Domain Sequences for d3dtgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dtgb_ e.17.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
leftvsantnpatdavresilanpgfgkyytdhmvsidytvdegwhnaqvipygpiqldp
saivlhygqeifeglkayrwadgsivsfrpeanaarlqssarrlaipelpeevfieslrq
liavdekwvppaggeeslylrpfviatepglgvrpsneyrylliaspagayfkggikpvs
vwlsheyvraspggtgaakfggnyaasllaqaqaaemgcdqvvwldaierryveemggmn
lffvfgsggsarlvtpelsgsllpgitrdsllqlatdagfaveerkidvdewqkkagage
itevfacgtaavitpvshvkhhdgeftiadgqpgeitmalrdtltgiqrgtfadthgwma
rln

SCOPe Domain Coordinates for d3dtgb_:

Click to download the PDB-style file with coordinates for d3dtgb_.
(The format of our PDB-style files is described here.)

Timeline for d3dtgb_: