Class b: All beta proteins [48724] (180 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
Protein automated matches [254425] (18 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [255783] (6 PDB entries) |
Domain d3cw2b3: 3cw2 B:321-415 [239193] Other proteins in same PDB: d3cw2a1, d3cw2a2, d3cw2b1, d3cw2b2, d3cw2c1, d3cw2c2, d3cw2c3, d3cw2d1, d3cw2d2, d3cw2d3, d3cw2e1, d3cw2e2, d3cw2f1, d3cw2f2, d3cw2g1, d3cw2g2, d3cw2g3, d3cw2h1, d3cw2h2, d3cw2h3 automated match to d2qn6a2 |
PDB Entry: 3cw2 (more details), 2.8 Å
SCOPe Domain Sequences for d3cw2b3:
Sequence, based on SEQRES records: (download)
>d3cw2b3 b.44.1.0 (B:321-415) automated matches {Sulfolobus solfataricus [TaxId: 2287]} aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev elrrpvavwsnnirtvisrqiagrwrmigwglvei
>d3cw2b3 b.44.1.0 (B:321-415) automated matches {Sulfolobus solfataricus [TaxId: 2287]} aevpvlwnirikynllgakemlkvdpiraketlmlsvgssttlgivtsvkkdeievelrr pvavwsnnirtvisrqiagrwrmigwglvei
Timeline for d3cw2b3: