SCOPe 2.07: Domain d3c60f1: 3c60 F:1-111

Lineage for d3c60f1 (3c60 F:1-111)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d3c60f1: 3c60 F:1-111 [239177]
   Other proteins in same PDB: d3c60a2, d3c60b2, d3c60c1, d3c60c2, d3c60d1, d3c60d2, d3c60e2, d3c60f2, d3c60g1, d3c60g2, d3c60h1, d3c60h2
   automated match to d2ak4e1

Details for d3c60f1

PDB Entry: 3c60, 3.05 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr yae62

PDB Compounds: (F:) TCR YAe62 beta chain

SCOPe Domain Sequences for d3c60f1:

Sequence; same for both SEQRES and ATOM records:

>d3c60f1 b.1.1.0 (F:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdfwgdtlyfgagtrlsvle

Timeline for d3c60f1:

• d3c60f1 first appeared in SCOPe 2.04
  
• d3c60f1 appears in SCOPe 2.06
  
• d3c60f1 appears in the current release, SCOPe 2.08