SCOPe 2.06: Domain d3c60e2: 3c60 E:112-201

Lineage for d3c60e2 (3c60 E:112-201)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)

8. Domain d3c60e2: 3c60 E:112-201 [239176]
   Other proteins in same PDB: d3c60a1, d3c60b1, d3c60c1, d3c60c2, d3c60d1, d3c60d2, d3c60e1, d3c60f1, d3c60g1, d3c60g2, d3c60h1, d3c60h2
   automated match to d2ak4d2

Details for d3c60e2

PDB Entry: 3c60, 3.05 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr yae62

PDB Compounds: (E:) TCR YAe62 alpha chain

SCOPe Domain Sequences for d3c60e2:

Sequence; same for both SEQRES and ATOM records:

>d3c60e2 b.1.1.2 (E:112-201) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
niqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafnnsiipedtffps

Timeline for d3c60e2:

• d3c60e2 first appeared in SCOPe 2.04
  
• d3c60e2 appears in SCOPe 2.05
  
• d3c60e2 appears in SCOPe 2.07
  
• d3c60e2 appears in the current release, SCOPe 2.08