SCOPe 2.07: Domain d3bqua2: 3bqu A:108-211

Lineage for d3bqua2 (3bqu A:108-211)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d3bqua2: 3bqu A:108-211 [239165]
   Other proteins in same PDB: d3bqua1, d3bquc1, d3bquc2, d3bqud1
   automated match to d2f5al2
   complexed with so4

Details for d3bqua2

PDB Entry: 3bqu, 3 Å

PDB Description: Crystal Structure of the 2F5 Fab'-3H6 Fab Complex

PDB Compounds: (A:) 2F5 Fab' light chain

SCOPe Domain Sequences for d3bqua2:

Sequence; same for both SEQRES and ATOM records:

>d3bqua2 b.1.1.2 (A:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyecevthqglsspvtksfnr

Timeline for d3bqua2:

• d3bqua2 first appeared in SCOPe 2.04
  
• d3bqua2 appears in SCOPe 2.06
  
• d3bqua2 appears in the current release, SCOPe 2.08