Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d3bqua2: 3bqu A:108-211 [239165] Other proteins in same PDB: d3bqua1, d3bquc1, d3bquc2, d3bqud1 automated match to d2f5al2 complexed with so4 |
PDB Entry: 3bqu (more details), 3 Å
SCOPe Domain Sequences for d3bqua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bqua2 b.1.1.2 (A:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyecevthqglsspvtksfnr
Timeline for d3bqua2: