Lineage for d3bqua1 (3bqu A:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743504Domain d3bqua1: 3bqu A:1-107 [239164]
    Other proteins in same PDB: d3bqua2, d3bquc1, d3bquc2, d3bqud1
    automated match to d1tjgl1
    complexed with so4

Details for d3bqua1

PDB Entry: 3bqu (more details), 3 Å

PDB Description: Crystal Structure of the 2F5 Fab'-3H6 Fab Complex
PDB Compounds: (A:) 2F5 Fab' light chain

SCOPe Domain Sequences for d3bqua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bqua1 b.1.1.1 (A:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvr

SCOPe Domain Coordinates for d3bqua1:

Click to download the PDB-style file with coordinates for d3bqua1.
(The format of our PDB-style files is described here.)

Timeline for d3bqua1: