Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
Protein automated matches [190787] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188042] (21 PDB entries) |
Domain d3be1a3: 3be1 A:322-487 [239159] Other proteins in same PDB: d3be1a2, d3be1a4, d3be1l1, d3be1l2 automated match to d1n8yc2 complexed with mes, nag |
PDB Entry: 3be1 (more details), 2.9 Å
SCOPe Domain Sequences for d3be1a3:
Sequence, based on SEQRES records: (download)
>d3be1a3 c.10.2.0 (A:322-487) automated matches {Human (Homo sapiens) [TaxId: 9606]} glgmehlrevravtsaniqefagckkifgslaflpesfdgdpasntaplqpeqlqvfetl eeitgylyisawpdslpdlsvfqnlqvirgrilhngaysltlqglgiswlglrslrelgs glalihhnthlcfvhtvpwdqlfrnphqallhtanrpedecvgegl
>d3be1a3 c.10.2.0 (A:322-487) automated matches {Human (Homo sapiens) [TaxId: 9606]} glgmehlrevravtsaniqefagckkifgslaflpesfdgntaplqpeqlqvfetleeit gylyisawpdslpdlsvfqnlqvirgrilhngaysltlqglgiswlglrslrelgsglal ihhnthlcfvhtvpwdqlfrnphqallhtanrpedecvgegl
Timeline for d3be1a3: