SCOPe 2.05: Domain d3be1a2: 3be1 A:165-321

Lineage for d3be1a2 (3be1 A:165-321)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (2 families)

5. Family g.3.9.0: automated matches [232406] (1 protein)
   not a true family

6. Protein automated matches [232407] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [232408] (7 PDB entries)

8. Domain d3be1a2: 3be1 A:165-321 [239158]
   Other proteins in same PDB: d3be1a1, d3be1a3, d3be1l1, d3be1l2
   automated match to d1n8yc3
   complexed with mes, nag

Details for d3be1a2

PDB Entry: 3be1, 2.9 Å

PDB Description: dual specific bh1 fab in complex with the extracellular domain of her2/erbb-2

PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d3be1a2:

Sequence; same for both SEQRES and ATOM records:

>d3be1a2 g.3.9.0 (A:165-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctg
pkhsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylst
dvgsctlvcplhnqevtaedgtqrcekcskpcarvcy

Timeline for d3be1a2:

• d3be1a2 first appeared in SCOPe 2.04
  
• d3be1a2 appears in SCOPe 2.06
  
• d3be1a2 appears in the current release, SCOPe 2.08